
Long R3 insulin-like growth factor-1
An 83-residue analogue of insulin-like growth factor-1, modified in two places so that it binds the IGF binding proteins far less readily than the native protein. It is a small protein rather than a short peptide, and it behaves like one — in the vial, in solution, and on a certificate.
Two modifications distinguish it from native IGF-1: an arginine in place of glutamic acid at position 3, and a 13-residue extension at the N-terminus. Both reduce affinity for the IGFBP family, which is the point — in serum-containing or serum-free culture, the binding proteins are what determine how much growth factor is actually free to signal.
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
|---|---|
| Length | 83 residues (70-residue IGF-1 core plus a 13-residue N-terminal extension) |
| Molecular formula | C400H625N111O115S9 |
| Molecular weight | 9117.50 g/mol |
| CAS number | 143045-27-6 (also cited as 946870-92-4 — see below) |
| Also known as | Long R3 IGF-1; LR3 IGF-1 |
| Appearance | White lyophilised powder |
| Storage | Sealed vial at −20°C; 2–8°C once in solution, and used promptly |
Native human IGF-1 is 70 residues and around 7.6 kDa. This is 83 residues and 9117.5 Da. That is not a subtle difference and there is no reason for a laboratory to be unsure which one it has measured. A certificate for material sold as LR3 that reports a mass near 7.6 kDa is describing native IGF-1 — a different, and considerably cheaper, protein.
Two further things worth knowing before you compare our figure with somebody else’s:
IGF-1 and its analogues are prohibited at all times in sport under the WADA List, and are treated as prescription-only medicines in a number of countries. This material is supplied for in-vitro laboratory research only: not for human or veterinary administration, not for diagnostic or therapeutic use, and we do not provide guidance on dosing or use. Card payment is not available for this compound — bank transfer or cryptocurrency only. If you are ordering from outside the UK, check that it may lawfully be imported where you are before you place the order; import rules for growth factors are stricter in many countries than for the short peptides we ship routinely.
The practical difference from the rest of our catalogue matters here. An 83-residue protein has real tertiary structure to lose, so it is less forgiving than a five-residue peptide: it denatures with agitation, with repeated freeze–thaw cycles, and at surfaces.
More on the general technique: how to reconstitute research peptides and reconstitution troubleshooting.
| Size | Price per vial |
|---|---|
| 1mg | £47 |
Independently batch tested. A batch-specific certificate of analysis is available on request — ask for the certificate for the batch we would ship you before you order. Published certificates are in the COA library, each with the issuing laboratory’s verification key.
View in catalogue & order Request a quote